DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and btn

DIOPT Version :10

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_732768.1 Gene:btn / 42664 FlyBaseID:FBgn0014949 Length:158 Species:Drosophila melanogaster


Alignment Length:69 Identity:40/69 - (57%)
Similarity:49/69 - (71%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 RRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDD 263
            |:.|||::.|||.:||.||.::.||.|.||.|||.:|:||||||||||||||||.||..|.:...
  Fly    87 RKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLEEQQG 151

  Fly   264 EDNK 267
            ...|
  Fly   152 SSAK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 Homeodomain 199..255 CDD:459649 36/55 (65%)
btnNP_732768.1 Homeodomain 87..143 CDD:459649 36/55 (65%)

Return to query results.
Submit another query.