DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and MEOX1

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_004518.1 Gene:MEOX1 / 4222 HGNCID:7013 Length:254 Species:Homo sapiens


Alignment Length:282 Identity:91/282 - (32%)
Similarity:117/282 - (41%) Gaps:74/282 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QTSLPVGGCGGAGVVGGVGGVGVSVGQP---GIGQQGVPPVPSVLMVNKMTPNCDKRSADTAYWM 93
            |...||.||               :..|   |.|..|:|..|.       ||....:..|.....
Human    13 QPPAPVWGC---------------LRNPHSEGNGASGLPHYPP-------TPFSFHQKPDFLATA 55

  Fly    94 TASEGGF----INSQPSMAEFLNHL-------SPESPKIGTPV-------GSGAIGG---VGVN- 136
            ||:...|    :.:.|.......|:       .|:||....||       .||..||   :|.: 
Human    56 TAAYPDFSASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSS 120

  Fly   137 ---VNVNVGVGVGYPVGVVPQTPDGMDSVPEYPWMKEKKTSRK----SSNNNNQGDNSITEFVPE 194
               |:...|.|..|  ||:..|.:          ..|||:||:    |.|..|:|.       ||
Human   121 LGLVDTTGGPGDDY--GVLGSTAN----------ETEKKSSRRRKESSDNQENRGK-------PE 166

  Fly   195 -NGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTL 258
             :...|:.|||:|..||.|||.||..:.||.|.||.|||.:|||:||||||||||||||.||...
Human   167 GSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKG 231

  Fly   259 SKTDDEDNKDSLKGDDDQSDSN 280
            .:....:.:|...||...|.|:
Human   232 GQPISPNGQDPEDGDSTASPSS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 52/110 (47%)
Homeobox 202..254 CDD:278475 36/51 (71%)
MEOX1NP_004518.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..178 31/110 (28%)
Homeobox 175..227 CDD:306543 36/51 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..254 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.