DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and Ubx

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:279 Identity:90/279 - (32%)
Similarity:121/279 - (43%) Gaps:77/279 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GGCGGAGVVGGVGGVGVSVGQPGI---GQQ----GVPPVPSVLMVNKMTPNCDKRSADTAYWMTA 95
            ||.||.|..||.||.|.:.|....   ||.    |:|..||.     .||  |.|          
  Fly   116 GGGGGGGGAGGTGGAGNANGGNAANANGQNNPAGGMPVRPSA-----CTP--DSR---------- 163

  Fly    96 SEGGFINSQPSMAEFLNHLSPESPK-------IGTPVGSGAIGGVGVNVNVNVGVGVGYPV---- 149
             .||::::...        ||.|.:       :....|:|..|||...|.| .|.|..:..    
  Fly   164 -VGGYLDTSGG--------SPVSHRGGSAGGNVSVSGGNGNAGGVQSGVGV-AGAGTAWNANCTI 218

  Fly   150 -GVVPQTPDGMDSVPE------YPWM------KEKKTSRKSSNNNNQ----------------GD 185
             |...||. ...|:.:      ||||      .|..|..|..::..|                ..
  Fly   219 SGAAAQTA-AASSLHQASNHTFYPWMAIAGECPEDPTKSKIRSDLTQYGGISTDMGKRYSESLAG 282

  Fly   186 NSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRR 250
            :.:.:::..|||.||.|..||..|.||||||||.|.||.|.||||:|.:|.|||||:|:||||||
  Fly   283 SLLPDWLGTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRR 347

  Fly   251 MKHKR--QTLSKTDDEDNK 267
            ||.|:  |.:.:.::::.:
  Fly   348 MKLKKEIQAIKELNEQEKQ 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 48/124 (39%)
Homeobox 202..254 CDD:278475 36/51 (71%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.