DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and shox2

DIOPT Version :10

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_957490.1 Gene:shox2 / 394171 ZFINID:ZDB-GENE-040426-1457 Length:299 Species:Danio rerio


Alignment Length:127 Identity:41/127 - (32%)
Similarity:60/127 - (47%) Gaps:21/127 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 PQTPDGMDSVPEYPWMKEKKTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEF 217
            |:..||...      |||:|...|...:..|  ..|.:        ||.||.:|..||.|||:.|
Zfish    79 PKLTDGNTD------MKERKEDCKPLEDETQ--TKIKQ--------RRSRTNFTLEQLNELERLF 127

  Fly   218 HFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSDS 279
            ....|.....|.|::..|.|:|.:|:|||||||.|.::|     :::.:|..|.|...|.::
Zfish   128 DETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQ-----ENQLHKGVLIGAASQFEA 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 Homeodomain 199..255 CDD:459649 26/55 (47%)
shox2NP_957490.1 Homeodomain 109..165 CDD:459649 26/55 (47%)
OAR 278..295 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.