DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and gsb

DIOPT Version :10

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_523863.1 Gene:gsb / 38005 FlyBaseID:FBgn0001148 Length:427 Species:Drosophila melanogaster


Alignment Length:61 Identity:14/61 - (22%)
Similarity:24/61 - (39%) Gaps:14/61 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 SFTFSPK-HSSSKTNLRQLNGREEDKEKKRFLGPISRTLSYLRSKMD--LALSTSSLYPSR 178
            |||...: ..:::|::...|           :.|...|:||:....|  .|..|....||:
  Fly    55 SFTHGNRSRRNARTSIEMTN-----------ILPALETISYISVARDKRAAKGTGGKLPSK 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 Homeodomain 199..255 CDD:459649
gsbNP_523863.1 PAX 19..143 CDD:128645 14/61 (23%)
Homeodomain 186..242 CDD:459649
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.