DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and Gsx2

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001131035.2 Gene:Gsx2 / 364140 RGDID:1308047 Length:305 Species:Rattus norvegicus


Alignment Length:277 Identity:79/277 - (28%)
Similarity:114/277 - (41%) Gaps:74/277 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TSLPVGGCGGAGVVGGVGGVGVSVGQPGI-GQQGVPPVPSVLMVNKMTPNCDKRSADTAYWMTAS 96
            :|.|..|.||    |..|..|.:|...|: |..|..|    |:.::.:|.    ..|..:....|
  Rat    71 SSRPPAGAGG----GATGTAGAAVAGGGVAGGTGALP----LLKSQFSPG----PGDAQFCPRVS 123

  Fly    97 EGGFINSQPSMAEFLNHLSPESPKIGTPVGSGAIGGVGVNVNVNVGVGVGYPVGVVPQTPDGMDS 161
            .....:..|.  ...:|..|:.|      ||.|...............:|:|....|..      
  Rat   124 HAHHHHHAPQ--HHHHHHQPQQP------GSAAAAAAAAAAAAAAAAALGHPQHHAPVC------ 174

  Fly   162 VPEYPWMKEKKTSRKSSNNNNQGD----------NSITEFVPENGLPRRLRTAYTNTQLLELEKE 216
                           ::...|..|          .|.|..|| ||  :|:|||:|:|||||||:|
  Rat   175 ---------------AATTYNVSDPRRFHCLTMGGSDTSQVP-NG--KRMRTAFTSTQLLELERE 221

  Fly   217 FHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQ-------------------TLSKTD 262
            |..|.||.|.||||||..|:|:|:|||:||||||:|||::                   ..::::
  Rat   222 FSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGASRNNHASCKCVGSQAHYARSE 286

  Fly   263 DEDNKDSLKGDDDQSDS 279
            |||:......::|:..|
  Rat   287 DEDSLSPASANEDKEIS 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 50/134 (37%)
Homeobox 202..254 CDD:278475 36/51 (71%)
Gsx2NP_001131035.2 Homeobox 207..260 CDD:395001 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.