DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and Meox1

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001102307.1 Gene:Meox1 / 363684 RGDID:1308911 Length:253 Species:Rattus norvegicus


Alignment Length:282 Identity:90/282 - (31%)
Similarity:114/282 - (40%) Gaps:67/282 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VQTGQTSLPVGGCGGAGVVGGVGGVGVSVGQP---GIGQQGVPPVPSVLMVNKMTPNCDKRSAD- 88
            |:..|...||.||               :..|   |....|:|..|.       ||....:.:| 
  Rat     9 VRNPQPPAPVWGC---------------LRNPHSEGSSASGLPHYPP-------TPFSFHQKSDF 51

  Fly    89 ---TAY--WMTASEGGFINSQPSMAEFLNHLSPESPKIGTPVGSGAIGGVGVNVNVNVG-----V 143
               .||  :.|:......:|.|......|...|..|:  ||.....|...|..:|:...     :
  Rat    52 PATAAYPDFSTSCLAATPHSLPRAERIFNEQHPAFPQ--TPDWHFPISEAGQRLNLGPAGSAREM 114

  Fly   144 GVGYPVGVVPQTPDGMDSVPE-------YPWMKEKKTSRKSSNNNNQGDNSITEFVPENG----- 196
            |.|.| |:|    ||...:.|       .....|||.||:   ...:.||      ||||     
  Rat   115 GAGSP-GLV----DGTGGLGEDCMVLGTIAHETEKKLSRR---KKERSDN------PENGGGKPE 165

  Fly   197 ---LPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTL 258
               ..|:.|||:|..||.|||.||..:.||.|.||.|||.:|||:||||||||||||||.||...
  Rat   166 GSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKG 230

  Fly   259 SKTDDEDNKDSLKGDDDQSDSN 280
            .:......:|...||...|.|:
  Rat   231 GQPVSPQEQDPEDGDSAASPSS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 52/113 (46%)
Homeobox 202..254 CDD:278475 36/51 (71%)
Meox1NP_001102307.1 COG5576 139..251 CDD:227863 54/120 (45%)
Homeobox 174..227 CDD:395001 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.