DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and pnx

DIOPT Version :10

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_840087.1 Gene:pnx / 352939 ZFINID:ZDB-GENE-030328-42 Length:182 Species:Danio rerio


Alignment Length:89 Identity:34/89 - (38%)
Similarity:47/89 - (52%) Gaps:12/89 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 NNNQGDNSITEFVPENGLP------------RRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIA 232
            :||:.....|....|...|            :|:|||:|..||..||:.|..:.||....|..||
Zfish    37 SNNRESPKTTSPTQEPSAPNIANASAAKVKSKRIRTAFTLDQLRILERSFQSSHYLSVFERHCIA 101

  Fly   233 ASLDLTERQVKVWFQNRRMKHKRQ 256
            ::|.|:|.|||:||||||.|.|::
Zfish   102 SALGLSETQVKIWFQNRRTKWKKE 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 Homeodomain 199..255 CDD:459649 28/55 (51%)
pnxNP_840087.1 Important for interaction with tle3a. /evidence=ECO:0000269|PubMed:12642490 1..34
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..63 5/25 (20%)
Homeodomain 68..124 CDD:459649 28/55 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.