DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and HMX3

DIOPT Version :10

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001099044.1 Gene:HMX3 / 340784 HGNCID:5019 Length:357 Species:Homo sapiens


Alignment Length:154 Identity:49/154 - (31%)
Similarity:64/154 - (41%) Gaps:50/154 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 SPESPKIGTPVGSGAIGGVGVNVNVNVGVGVGYPVGVVPQTPDGMDSVPEYPWMK-----EKKTS 174
            |.||.|    .|..|.|..|.:            ||....||...|      |.|     |||.:
Human   182 SEESKK----EGEAAPGAAGAS------------VGAAAATPGAED------WKKGAESPEKKPA 224

  Fly   175 -RKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLT 238
             ||                      ::.||.::.:|:.:||..|...:||....|..:||||.||
Human   225 CRK----------------------KKTRTVFSRSQVFQLESTFDMKRYLSSSERAGLAASLHLT 267

  Fly   239 ERQVKVWFQNRRMKHKRQTLSKTD 262
            |.|||:||||||.|.|||..::.:
Human   268 ETQVKIWFQNRRNKWKRQLAAELE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 Homeodomain 199..255 CDD:459649 26/55 (47%)
HMX3NP_001099044.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..58
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..229 20/90 (22%)
Homeodomain 228..284 CDD:459649 26/55 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.