DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and HOXD1

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_078777.1 Gene:HOXD1 / 3231 HGNCID:5132 Length:328 Species:Homo sapiens


Alignment Length:274 Identity:77/274 - (28%)
Similarity:97/274 - (35%) Gaps:105/274 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PLQVQTGQTSL---------PVGGCGGA--------------GVVGGV----------------- 49
            |...|..|.:|         |....|||              ||:|..                 
Human    77 PAAPQYAQCTLEGAYEPGAAPAAAAGGADYGFLGSGPAYDFPGVLGRAADDGGSHVHYATSAVFS 141

  Fly    50 -GGVGVSVGQPGIGQQGVP-PVPSVLMVNKMTPNCDKRSADTAYWMTASEGGFINSQPSMAEFLN 112
             ||..:..||......|.| |.|:          |.|.|||      ...|.|..:.|:...:..
Human   142 GGGSFLLSGQVDYAAFGEPGPFPA----------CLKASAD------GHPGAFQTASPAPGTYPK 190

  Fly   113 HLSPESPKIGTPVGSGAIGGVGVNVNVNVGVGVGYPVGVVPQTPDGMDSVPEYPWMKEKKTSRKS 177
            .:||.|                           |.|.           :...:.|||.|:.:.|.
Human   191 SVSPAS---------------------------GLPA-----------AFSTFEWMKVKRNASKK 217

  Fly   178 SNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQV 242
            ......|..|     |.:.    :||.::..||.||||||||||||.|.||||||..|.|.:.||
Human   218 GKLAEYGAAS-----PSSA----IRTNFSTKQLTELEKEFHFNKYLTRARRIEIANCLHLNDTQV 273

  Fly   243 KVWFQNRRMKHKRQ 256
            |:||||||||.|::
Human   274 KIWFQNRRMKQKKR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 44/89 (49%)
Homeobox 202..254 CDD:278475 36/51 (71%)
HOXD1NP_078777.1 Antp-type hexapeptide 204..209 1/4 (25%)
Homeobox 233..285 CDD:278475 36/51 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.