DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and HOXC5

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_061826.1 Gene:HOXC5 / 3222 HGNCID:5127 Length:222 Species:Homo sapiens


Alignment Length:249 Identity:77/249 - (30%)
Similarity:102/249 - (40%) Gaps:77/249 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 CGGAGVVGGV-------GGVGVSVGQPGIGQQGVPPVPS-----VLMVNKMTPNCDKRSADTAYW 92
            ||..|....|       ||:.:|:..|       ||.||     |.|......:.|:.:...|  
Human    24 CGNYGSASEVQASRYCYGGLDLSITFP-------PPAPSNSLHGVDMAANPRAHPDRPACSAA-- 79

  Fly    93 MTASEGGFINSQPSMAEFLNHLSPESP-----KIGTPV------GSGAIGGVGVNVNVNVGVGVG 146
                      :.|..|...:..:|.:|     |...|.      .||.|        .......|
Human    80 ----------AAPGHAPGRDEAAPLNPGMYSQKAARPALEERAKSSGEI--------KEEQAQTG 126

  Fly   147 YPVGV-VPQTPDGMDSVPE-YPWMKEKKTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQ 209
            .|.|: .|..|      |: ||||.:...|.::..                   :|.||:||..|
Human   127 QPAGLSQPPAP------PQIYPWMTKLHMSHETDG-------------------KRSRTSYTRYQ 166

  Fly   210 LLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDD 263
            .||||||||||:||.|.||||||.:|.|.|||:|:||||||||.|:.:..|:.:
Human   167 TLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSKE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 43/96 (45%)
Homeobox 202..254 CDD:278475 38/51 (75%)
HOXC5NP_061826.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..141 17/98 (17%)
Antp-type hexapeptide 140..145 3/4 (75%)
Homeobox 158..211 CDD:306543 38/52 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.