Sequence 1: | NP_476669.3 | Gene: | pb / 40826 | FlyBaseID: | FBgn0051481 | Length: | 782 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004493.3 | Gene: | HOXB7 / 3217 | HGNCID: | 5118 | Length: | 217 | Species: | Homo sapiens |
Alignment Length: | 237 | Identity: | 74/237 - (31%) |
---|---|---|---|
Similarity: | 97/237 - (40%) | Gaps: | 74/237 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 KRSADTAYWMTASEGGFINSQPSMAEFLNHLSPESPKIGTPVGSGAI----------GGVGVNVN 138
Fly 139 VNVGV-GVGYPV-----------------GVVP---------QTPDGMDSVPE-----YPWMKEK 171
Fly 172 KTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLD 236
Fly 237 LTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSD 278 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
pb | NP_476669.3 | COG5576 | 168..274 | CDD:227863 | 44/105 (42%) |
Homeobox | 202..254 | CDD:278475 | 37/51 (73%) | ||
HOXB7 | NP_004493.3 | Antp-type hexapeptide | 126..131 | 3/4 (75%) | |
Homeobox | 141..193 | CDD:278475 | 37/51 (73%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 194..217 | 1/22 (5%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |