DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and HOXB7

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_004493.3 Gene:HOXB7 / 3217 HGNCID:5118 Length:217 Species:Homo sapiens


Alignment Length:237 Identity:74/237 - (31%)
Similarity:97/237 - (40%) Gaps:74/237 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 KRSADTAYWMTASEGGFINSQPSMAEFLNHLSPESPKIGTPVGSGAI----------GGVGVNVN 138
            |..|.::.:.|    |....|.|.|...|   |:.|..|  .||||.          ||.|:...
Human    13 KYPASSSVFAT----GAFPEQTSCAFASN---PQRPGYG--AGSGASFAASMQGLYPGGGGMAGQ 68

  Fly   139 VNVGV-GVGYPV-----------------GVVP---------QTPDGMDSVPE-----YPWMKEK 171
            ...|| ..||.:                 ||.|         :.....|...|     ||||:..
Human    69 SAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSS 133

  Fly   172 KTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLD 236
            .|.||                       |.|..||..|.||||||||:|:||.|.||||||.:|.
Human   134 GTDRK-----------------------RGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLC 175

  Fly   237 LTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSD 278
            |||||:|:||||||||.|::..:.......:|..:.::::.:
Human   176 LTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 44/105 (42%)
Homeobox 202..254 CDD:278475 37/51 (73%)
HOXB7NP_004493.3 Antp-type hexapeptide 126..131 3/4 (75%)
Homeobox 141..193 CDD:278475 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..217 1/22 (5%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.