Sequence 1: | NP_476669.3 | Gene: | pb / 40826 | FlyBaseID: | FBgn0051481 | Length: | 782 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011523029.1 | Gene: | HOXB6 / 3216 | HGNCID: | 5117 | Length: | 288 | Species: | Homo sapiens |
Alignment Length: | 253 | Identity: | 78/253 - (30%) |
---|---|---|---|
Similarity: | 102/253 - (40%) | Gaps: | 79/253 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 PPVP-SVLMVNKMTPNCDKRSADTAYWMTASEG--GFINSQP----SMAEFLNHL-SPESPKIGT 123
Fly 124 PVGSG-------AIGGVGVNVNVNVGVGVGY------------------------------PVGV 151
Fly 152 VPQTPDGMDSVPEYPWMKEKKTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKE 216
Fly 217 FHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQT-------LSKTDDEDNK 267 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
pb | NP_476669.3 | COG5576 | 168..274 | CDD:227863 | 48/107 (45%) |
Homeobox | 202..254 | CDD:278475 | 37/51 (73%) | ||
HOXB6 | XP_011523029.1 | Homeobox | 214..266 | CDD:278475 | 37/51 (73%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |