DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and HOXB3

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:XP_016880049.1 Gene:HOXB3 / 3213 HGNCID:5114 Length:578 Species:Homo sapiens


Alignment Length:434 Identity:109/434 - (25%)
Similarity:152/434 - (35%) Gaps:165/434 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SESPLNPLQVQ--TGQTSLP-----------------VGGCGGAGVVGGVGG----VGVSVG--- 57
            |.||..|.:..  :|...||                 .||.||.||.....|    :|.::|   
Human    41 SRSPARPGRSGSFSGNWRLPRPECQIRALLGPWRPNKAGGGGGGGVGASASGPLPQLGGTLGGCW 105

  Fly    58 ----------------QPGIGQ-----QGVP-----------PVPS------------------- 71
                            .|.:|:     |..|           |.||                   
Human   106 GLLRVERLGCGWLRRRSPSLGRGSGAWQSAPARTQRPAARRCPRPSGRPHRRGDLSPAARSGARC 170

  Fly    72 -VLMVNKMTPNCDKRSADTAYWMTASEGGFINSQPSMAEFLN---H--------------LSPES 118
             .::...:.|:...::|      |..||.:..|..|:....|   |              |:|| 
Human   171 EYILCLPVLPSSVAKAA------THLEGDYQRSACSLQSLGNAAPHAKSKELNGSCMRPGLAPE- 228

  Fly   119 PKIGTPVGSGAIGGVGVNVNVNVGVGVGYPVGVVPQTPDGMDSV---PEYPWMKEKKTSRKSSNN 180
             .:..|.||........:...|...|.|......|:...|.:|.   ..:|||||.:.:.|..||
Human   229 -PLSAPPGSPPPSAAPTSATSNSSNGGGPSKSGPPKCGPGTNSTLTKQIFPWMKESRQTSKLKNN 292

  Fly   181 N-----------------------------NQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKE 216
            :                             ..||.|    .|.:...:|.|||||:.||:|||||
Human   293 SPGTAEGCGGGGGGGGGGGSGGSGGGGGGGGGGDKS----PPGSAASKRARTAYTSAQLVELEKE 353

  Fly   217 FHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSDSNS 281
            ||||:|||||||:|:|..|:|:|||:|:||||||||:|:                      |..:
Human   354 FHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKK----------------------DQKA 396

  Fly   282 NSKKSCQGCELPSDDIPDSTSNSRGHNN----NTPSATNNNPSA 321
            ....|..|...|:...|....::.|..|    .|||..:.:|.|
Human   397 KGLASSSGGPSPAGSPPQPMQSTAGFMNALHSMTPSYESPSPPA 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 51/134 (38%)
Homeobox 202..254 CDD:278475 39/51 (76%)
HOXB3XP_016880049.1 Homeobox 339..391 CDD:278475 39/51 (76%)
DUF4074 513..576 CDD:290032
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4526
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.