DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and HOXB2

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_002136.1 Gene:HOXB2 / 3212 HGNCID:5113 Length:356 Species:Homo sapiens


Alignment Length:339 Identity:123/339 - (36%)
Similarity:156/339 - (46%) Gaps:63/339 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EGGFINSQPSMAEFLNHLS-----------PESPKIGTP---------VGSGAIGGVGVNVNVNV 141
            |.||||||||:||.|....           .||..|..|         :..||............
Human     8 EIGFINSQPSLAECLTSFPAVLETFQTSSIKESTLIPPPPPFEQTFPSLQPGASTLQRPRSQKRA 72

  Fly   142 GVGVGYPVGVVPQTPDGMDSVPEYPWMKEKKTSRKSSNNNNQGDNSITEFVPEN---------GL 197
            ..|...|....|..| .....||:|||||||:::|.|.:.. ..:.....||.:         ||
Human    73 EDGPALPPPPPPPLP-AAPPAPEFPWMKEKKSAKKPSQSAT-SPSPAASAVPASGVGSPADGLGL 135

  Fly   198 P-------RRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKR 255
            |       ||||||||||||||||||||||||||||||:||||.|||||||||||||||||||||
Human   136 PEAGGGGARRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKR 200

  Fly   256 QTLSKTDDEDNKDSLKGD-DDQSD----------SNSNSKKSCQGCELPSDDIPDSTS------- 302
            ||..: :..|.:.:..|. :|..|          ..|.|:.:.:.|..|.:.:|.:.|       
Human   201 QTQHR-EPPDGEPACPGALEDICDPAEEPAASPGGPSASRAAWEACCHPPEVVPGALSADPRPLA 264

  Fly   303 -NSRGHNNNTPSATNNNPSAGNLTPNSSLETGISSNLMGSTTVSASNVISADSSVASSVSLDEDI 366
             ...|...::|.....  .||.|.| ..|...:.|....|..:...|..:|||.:..|..|...:
Human   265 VRLEGAGASSPGCALR--GAGGLEP-GPLPEDVFSGRQDSPFLPDLNFFAADSCLQLSGGLSPSL 326

  Fly   367 EES--SPIKVKKKD 378
            :.|  ||:...:::
Human   327 QGSLDSPVPFSEEE 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 71/122 (58%)
Homeobox 202..254 CDD:278475 49/51 (96%)
HOXB2NP_002136.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..142 26/104 (25%)
Antp-type hexapeptide 94..99 3/4 (75%)
Homeobox 147..199 CDD:278475 49/51 (96%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..240 12/43 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158764
Domainoid 1 1.000 117 1.000 Domainoid score I5916
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm40786
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45664
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6877
SonicParanoid 1 1.000 - - X2356
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.