DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and Hoxc5

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001101586.1 Gene:Hoxc5 / 315341 RGDID:1307584 Length:222 Species:Rattus norvegicus


Alignment Length:257 Identity:73/257 - (28%)
Similarity:104/257 - (40%) Gaps:93/257 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 CGGAGVVGGV-------GGVGVSVGQPGIGQQGVPPVPSVLMVNKM--------------TPNCD 83
            ||..|....|       ||:.:|:..|       ||.||    |.:              .|.|.
  Rat    24 CGNYGSASEVQASRYCYGGLDLSITFP-------PPAPS----NSLHGVDMAANPRAHPDRPACS 77

  Fly    84 KRSADTAYWMTASEGGFIN--------SQPSM---AEFLNHLSPESPKIGTPVGSGAIGGVGVNV 137
            ..:| ..:.:...|...:|        ::|::   |:....:..|..:.|.|.|           
  Rat    78 AAAA-PGHALGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKEEQAQTGQPAG----------- 130

  Fly   138 NVNVGVGVGYPVGVVPQTPDGMDSVPE-YPWMKEKKTSRKSSNNNNQGDNSITEFVPENGLPRRL 201
                          :.|.|    :.|: ||||.:...|.::..                   :|.
  Rat   131 --------------LSQPP----APPQIYPWMTKLHMSHETDG-------------------KRS 158

  Fly   202 RTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDD 263
            ||:||..|.||||||||||:||.|.||||||.:|.|.|||:|:||||||||.|:.:..|:.:
  Rat   159 RTSYTRYQTLELEKEFHFNRYLTRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSKE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 43/96 (45%)
Homeobox 202..254 CDD:278475 38/51 (75%)
Hoxc5NP_001101586.1 COG5373 65..>142 CDD:227665 14/106 (13%)
Homeobox 158..212 CDD:395001 38/53 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.