DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and pdx1

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_571518.2 Gene:pdx1 / 30721 ZFINID:ZDB-GENE-990415-122 Length:246 Species:Danio rerio


Alignment Length:242 Identity:78/242 - (32%)
Similarity:109/242 - (45%) Gaps:69/242 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PVPSVLMVNKMTPNCDKRSADTAYWMTASEGGFINSQPSMAEFLNH-LSPE----SPKIGTPVGS 127
            |.|.:.|          |.|.:.|   ||..| ...||::.:..:: :|..    .|.:..|..|
Zfish    32 PPPCLYM----------RQAHSVY---ASPLG-AQDQPNLTDITSYNMSSRDDLAGPHLHLPQTS 82

  Fly   128 ----GAIGGVGVNVNVNVGVGVGYPVGVVPQTPDGMDSVPE-------YPWMKEKKTSRKSSNNN 181
                .::||.|                      |.:|...:       :||||..|:...:....
Zfish    83 QTSLQSLGGYG----------------------DSLDLCGDRNRYHLPFPWMKSTKSHTHAWKGQ 125

  Fly   182 NQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWF 246
            ..|...:.  ..||   :|.|||||..|||||||||.||||:.||||:|:|.:|.||||.:|:||
Zfish   126 WTGPYMVE--AEEN---KRTRTAYTRAQLLELEKEFLFNKYISRPRRVELALTLSLTERHIKIWF 185

  Fly   247 QNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSDSNSNS----KKSCQG 289
            ||||||.|:        |::|...:|.|.:.||:..|    .:||.|
Zfish   186 QNRRMKWKK--------EEDKRRARGVDPEQDSSITSGDLKDESCVG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 49/105 (47%)
Homeobox 202..254 CDD:278475 38/51 (75%)
pdx1NP_571518.2 Homeobox 140..193 CDD:278475 38/52 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.