DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and dlx6a

DIOPT Version :10

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_571398.1 Gene:dlx6a / 30586 ZFINID:ZDB-GENE-980526-448 Length:247 Species:Danio rerio


Alignment Length:118 Identity:44/118 - (37%)
Similarity:64/118 - (54%) Gaps:18/118 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 RRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDD 263
            |:.||.|::.||..|...|...:||..|.|.|:||||.||:.|||:||||:|.|.|: .|.:..:
Zfish   126 RKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKK-LLKQGGN 189

  Fly   264 EDNKDSLKGDDDQSDSNSNSKKSCQGCELPSDDIP---DSTSNSRGHNNNTPS 313
            ....|:|.|      |.:.|.:|      |:  ||   |.:::|:|.|.:..|
Zfish   190 PHETDTLPG------SIALSPRS------PA--IPPIWDVSASSKGVNMSANS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 Homeodomain 199..255 CDD:459649 28/55 (51%)
dlx6aNP_571398.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..66
Homeodomain 126..182 CDD:459649 28/55 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.