DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and hoxc3a

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001128157.2 Gene:hoxc3a / 30421 ZFINID:ZDB-GENE-980526-532 Length:263 Species:Danio rerio


Alignment Length:162 Identity:66/162 - (40%)
Similarity:88/162 - (54%) Gaps:27/162 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 SVPEYPWMKE--KKTSRKSSNNNNQGDNSIT--EFVPENGLPRRLRTAYTNTQLLELEKEFHFNK 221
            |..:||||:|  ..|...|.|....||:..:  |.|..|...:|.|.|:|::|||||||||||:.
Zfish   117 STMKYPWMRETHAPTHFSSINAMESGDSKYSNGEAVVRNSSSKRARVAFTSSQLLELEKEFHFSA 181

  Fly   222 YLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSDSNSNSKKS 286
            ||||.||:|:|..|.||:||:|:||||||||:|:                  |.:..|.:.|..:
Zfish   182 YLCRNRRLEMAELLKLTDRQIKIWFQNRRMKYKK------------------DHKEKSTAKSSYT 228

  Fly   287 CQGCELPSDDIPDSTSNS----RGHNN-NTPS 313
            ..|.|.....|..||::|    :..|| .|||
Zfish   229 YLGTENQPLIISRSTTDSPVPLKFQNNYETPS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 48/109 (44%)
Homeobox 202..254 CDD:278475 36/51 (71%)
hoxc3aNP_001128157.2 Abdominal-A 123..246 CDD:332641 57/140 (41%)
Homeobox 162..214 CDD:306543 36/51 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.