DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and hoxd3a

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_571200.1 Gene:hoxd3a / 30349 ZFINID:ZDB-GENE-990415-120 Length:396 Species:Danio rerio


Alignment Length:302 Identity:92/302 - (30%)
Similarity:129/302 - (42%) Gaps:76/302 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 TASEGGFINSQPSMAEFLNHLSP---ESPKIGT--------PVGSGAIGGVGVNVNVNVGVGVGY 147
            :||:|   ||||.........:|   .||...|        |..:|:                  
Zfish    72 SASQG---NSQPESISEQQQAAPLAASSPSPSTNSTQKKKSPSSNGS------------------ 115

  Fly   148 PVGVVPQTPDGMDSVPEYPWMKE-KKTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLL 211
                  .|...:.|...:||||| ::.:::.|.|......:..:..|.....:|:|||||:.||:
Zfish   116 ------STATPVISKQIFPWMKETRQNAKQKSTNCPAAGETCDDKSPPGPASKRVRTAYTSAQLV 174

  Fly   212 ELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDEDNK----DSLKG 272
            |||||||||:|||||||:|:|..|:|||||:|:||||||||:|:       |:.:|    ..|..
Zfish   175 ELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKK-------DQKSKGIMHSPLGH 232

  Fly   273 DDDQSDSNSNSKKSCQGCELP-----SDDIPDSTSNSRGHNNNTPSATNNNPSAG---------- 322
            ..|:|...|.|.......:||     |.|.|...|.::...|....|....|..|          
Zfish   233 SPDRSPPLSGSNHIGYSGQLPNVNSLSYDAPSPPSFAKPQQNIYGLAAYTAPLGGCIPQQKRYPG 297

  Fly   323 ------NLTPNSSLETGISSNLMGSTTVSASNVISADSSVAS 358
                  ::..|.|.   .::||..|......|.:  ||..||
Zfish   298 TEYDHHSMQGNGSF---ANANLQSSPVYVGGNFV--DSMPAS 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 51/110 (46%)
Homeobox 202..254 CDD:278475 40/51 (78%)
hoxd3aNP_571200.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..163 23/117 (20%)
Abdominal-A 116..237 CDD:332641 56/127 (44%)
Antp-type hexapeptide 126..131 2/4 (50%)
Homeobox 165..217 CDD:306543 40/51 (78%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..246 7/26 (27%)
DUF4074 333..394 CDD:315871 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..396
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.