DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and Hoxb3

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001100512.1 Gene:Hoxb3 / 303488 RGDID:1310780 Length:429 Species:Rattus norvegicus


Alignment Length:351 Identity:102/351 - (29%)
Similarity:142/351 - (40%) Gaps:67/351 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GGVGVSVGQPGIGQQGVPPVPSVLMVNKMTPNCDKRSADTAYWMTASEGGFINSQP-SMAEFLN- 112
            ||.....|..|.|..| ||.|.......:..:. :|||       .|.....|:.| :.::.|| 
  Rat    16 GGYSSYPGSNGFGYDG-PPQPPFQAATHLEGDY-QRSA-------CSLQSLGNAAPHAKSKELNG 71

  Fly   113 -----HLSPESPKIGTPVGSGAIGGVGVNVNVNVGVGVGYPVGVVPQTPDGMDSV---PEYPWMK 169
                 .|:||  .:..|.||........:...|...|.|......|:.....:|.   ..:||||
  Rat    72 SCMRPGLAPE--PLPAPPGSPPPSAAPTSTTSNSNNGGGPSKSGPPKCGASSNSTLTKQIFPWMK 134

  Fly   170 EKKTSRK------------------------SSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQL 210
            |.:.:.|                        ||.....|.....:..|.:...:|.|||||:.||
  Rat   135 ESRQTSKLKNSSPGTAEGCGGGGGGGGGGGSSSGGGGSGGGGGDKSPPGSAASKRARTAYTSAQL 199

  Fly   211 LELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDD 275
            :|||||||||:|||||||:|:|..|:|:|||:|:||||||||:|:...:|     ...|..|...
  Rat   200 VELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKAK-----GLASSSGGPS 259

  Fly   276 QSDSNSNSKKSCQG------CELPSDDIPDSTSNSRGHNNNTPSATNNNPSAGNL--------TP 326
            .:.|.....:|..|      ...||.|.|...:.|:||.|.....:|..|.....        ||
  Rat   260 PAGSPPQPMQSTAGFMNALHSMTPSYDSPSPPAFSKGHQNAYALPSNYQPPLKGCGAPQKYPPTP 324

  Fly   327 NSSLETGI---SSNLMGSTTVSASNV 349
            ....|:.:   :....|:.|:..|.|
  Rat   325 APEYESHVLQANGGAYGTPTMQGSPV 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 52/129 (40%)
Homeobox 202..254 CDD:278475 39/51 (76%)
Hoxb3NP_001100512.1 Homeobox 191..244 CDD:395001 39/52 (75%)
DUF4074 365..427 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.