DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and hoxc6a

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_571198.1 Gene:hoxc6a / 30346 ZFINID:ZDB-GENE-990415-113 Length:231 Species:Danio rerio


Alignment Length:128 Identity:52/128 - (40%)
Similarity:69/128 - (53%) Gaps:29/128 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 DSVPEYPWMKEKKTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLC 224
            :::..||||:..        |::.|       |......||.|..|:..|.||||||||||:||.
Zfish   119 NNIQIYPWMQRM--------NSHSG-------VGYGSDRRRGRQIYSRYQTLELEKEFHFNRYLT 168

  Fly   225 RPRRIEIAASLDLTERQVKVWFQNRRMKHKRQ--------------TLSKTDDEDNKDSLKGD 273
            |.||||||.:|.|||||:|:||||||||.|::              |..:|:.|..::..|.|
Zfish   169 RRRRIEIANALCLTERQIKIWFQNRRMKWKKETNLTSTVPGTESAGTPQETEKETEEEPKKKD 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 49/120 (41%)
Homeobox 202..254 CDD:278475 37/51 (73%)
hoxc6aNP_571198.1 Antp-type hexapeptide 123..128 3/4 (75%)
Homeobox 146..198 CDD:278475 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..231 4/30 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.