DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and hoxb6a

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_571194.1 Gene:hoxb6a / 30341 ZFINID:ZDB-GENE-990415-106 Length:228 Species:Danio rerio


Alignment Length:122 Identity:55/122 - (45%)
Similarity:71/122 - (58%) Gaps:20/122 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 VVPQTPDGMDSVPEYPWMKEKKTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEK 215
            :.|:..:...|.|.||||:     |.:|.|...|:..           ||.|..||..|.|||||
Zfish   119 IYPEADEQKPSAPVYPWMQ-----RMNSCNGTFGNAG-----------RRGRQTYTRYQTLELEK 167

  Fly   216 EFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQ----TLSKTDDEDNKD 268
            |||||:||.|.||||||.:|.|||||:|:||||||||.|::    ..|:|..|:.::
Zfish   168 EFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKLINCSQTSGEEEEE 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 49/105 (47%)
Homeobox 202..254 CDD:278475 38/51 (75%)
hoxb6aNP_571194.1 Antp-type hexapeptide 132..137 3/4 (75%)
Homeobox 154..206 CDD:278475 38/51 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.