DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and hoxb4a

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_571193.1 Gene:hoxb4a / 30340 ZFINID:ZDB-GENE-990415-105 Length:246 Species:Danio rerio


Alignment Length:178 Identity:64/178 - (35%)
Similarity:82/178 - (46%) Gaps:49/178 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 VVPQTPDGMDSVPE---------------YPWMKEKKTSRKSSNNNNQGDNSITEFVPENGLPRR 200
            |.|..|......|.               |||||:...:..|.|.:             .|.|:|
Zfish   102 VTPSPPPACGQTPTSQNTSTVSSRKDPVVYPWMKKVHVNIVSPNYS-------------GGEPKR 153

  Fly   201 LRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDED 265
            .|||||..|:||||||||:|:||.|.||:|||.:|.|:|||:|:||||||||.|:         |
Zfish   154 SRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHTLCLSERQIKIWFQNRRMKWKK---------D 209

  Fly   266 NKDSLKGDDDQSDSNSNSKKSCQGCELPSDDIPDSTSNSRGHNNNTPS 313
            :|  |.....:|:|.|.:...|          |...||....:...||
Zfish   210 HK--LPNTKIRSNSASTNSSGC----------PTLCSNQSRASGPPPS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 48/105 (46%)
Homeobox 202..254 CDD:278475 37/51 (73%)
hoxb4aNP_571193.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..125 4/22 (18%)
Antp-type hexapeptide 130..135 3/4 (75%)
Homeobox 154..207 CDD:278475 37/52 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..246 11/48 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.