DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and hoxb1a

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_571190.2 Gene:hoxb1a / 30337 ZFINID:ZDB-GENE-990415-101 Length:316 Species:Danio rerio


Alignment Length:283 Identity:89/283 - (31%)
Similarity:119/283 - (42%) Gaps:85/283 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GVGVSVGQPGIGQQGVPPVPSVLMVNKMTPNCDKRSADTAYWMTASEGGFINSQPSMAEFLNH-- 113
            |:|::.|..|....|             |..|    |::.|   |....|||  |.......|  
Zfish    86 GMGLTYGGTGTTSYG-------------TQAC----ANSDY---AQHQYFIN--PEQDGMYYHSS 128

  Fly   114 ---LSPESPKIGTPVGS--GAIGGV---------------------GVNVNVNVGVGVGYPVGVV 152
               .|..||..|:..|:  ||.|.|                     |...:::...|....   .
Zfish   129 GFSTSNASPHYGSMAGAYCGAQGAVPAAPYQHHGCEGQDHQRAYSQGTYADLSASQGTEKD---T 190

  Fly   153 PQTPDGMDSVPEYPWMKEKKTSRKSSNNNNQGDNSITEFVPENGL-PRR-LRTAYTNTQLLELEK 215
            .|.|.|    ..:.|||.|:...|:..            |.|.|| |:. :||.:|..||.||||
Zfish   191 DQPPPG----KTFDWMKVKRNPPKTGK------------VAEYGLGPQNTIRTNFTTKQLTELEK 239

  Fly   216 EFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHK---RQTLSKTDDEDNKDSLKGDDDQS 277
            ||||:|||.|.||:||||:|:|.|.|||:||||||||.|   ::.|:......:||.    :|||
Zfish   240 EFHFSKYLTRARRVEIAATLELNETQVKIWFQNRRMKQKKREKEGLAPASSTSSKDL----EDQS 300

  Fly   278 DSNSNSKKSCQGCELPSDDIPDS 300
            |.::::.....    ||   |||
Zfish   301 DHSTSTSPEAS----PS---PDS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 50/110 (45%)
Homeobox 202..254 CDD:278475 37/51 (73%)
hoxb1aNP_571190.2 Homeobox 226..278 CDD:278475 37/51 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.