DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and hoxd4a

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001119917.1 Gene:hoxd4a / 30329 ZFINID:ZDB-GENE-980526-214 Length:256 Species:Danio rerio


Alignment Length:199 Identity:67/199 - (33%)
Similarity:91/199 - (45%) Gaps:30/199 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SADTAYWMTASEGGFINSQPSMAEFLNHLSPESPKIGTPVGSGAIGGVGVNVNVNVGVGVGYPVG 150
            |..|....:....|.:..|.|........:.:.|.:  .:.....||...|.....|:....|..
Zfish    82 SCSTVQGSSVQPRGHVQDQASTPSPFPAQTEQCPAV--QISGSRTGGQQQNTKTQNGIPTKQPAV 144

  Fly   151 VVPQTPDGMDSVPEYPWMKEKKTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEK 215
            |             ||||  ||....:.|.:..|        ||   |:|.|||||..|:|||||
Zfish   145 V-------------YPWM--KKVHVTTVNPDYTG--------PE---PKRSRTAYTRQQVLELEK 183

  Fly   216 EFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSDSN 280
            |||||:||.|.||||||.:|.|:|||:|:||||||||.|:.  .|..:...:.:..|:.....:.
Zfish   184 EFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKD--HKLPNTKGRSASVGNQHAQHAQ 246

  Fly   281 SNSK 284
            .:|:
Zfish   247 KDSQ 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 51/105 (49%)
Homeobox 202..254 CDD:278475 39/51 (76%)
hoxd4aNP_001119917.1 Homeobox 169..222 CDD:278475 39/52 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.