DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and Gsx1

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001178592.1 Gene:Gsx1 / 288457 RGDID:1310020 Length:261 Species:Rattus norvegicus


Alignment Length:123 Identity:53/123 - (43%)
Similarity:74/123 - (60%) Gaps:26/123 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 NGLP--RRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQT 257
            |.||  :|:|||:|:|||||||:||..|.||.|.||||||..|:|:|:|||:||||||:|||::.
  Rat   141 NQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEG 205

  Fly   258 LSKTDDEDNKDSLKGDDDQSDSNSNSKKSC-QGCELPS----------DDIPDSTSNS 304
                         ||.:.:..:.:.:.... |||:..|          |::|.|.|:|
  Rat   206 -------------KGSNHRGGAGAGAGGGAPQGCKCSSLSSAKCSEDDDELPMSPSSS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 44/80 (55%)
Homeobox 202..254 CDD:278475 36/51 (71%)
Gsx1NP_001178592.1 Homeobox 150..202 CDD:278475 36/51 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.