DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and ind

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_996087.2 Gene:ind / 2768974 FlyBaseID:FBgn0025776 Length:320 Species:Drosophila melanogaster


Alignment Length:236 Identity:72/236 - (30%)
Similarity:102/236 - (43%) Gaps:62/236 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 GFINSQ---PSMAEFLNHLSPESPKIGTPVGSGAIGGVGV--------NVNVNVGVGVGYPVGVV 152
            ||.|.:   ||.....|..|.:.|.|....||..:||:.:        :.:.:....:.|     
  Fly   121 GFSNYEGCYPSPPLSANPNSQQLPPIHNLYGSPVVGGLPLPEPGSFCTSPSASSSASLDY----- 180

  Fly   153 PQTPDGMDSVPEYPWMKEKKTSRKSS---NNNNQGDNSITEFVPENG-LPRRLRTAYTNTQLLEL 213
               .:..|......:..|...|..||   |:::.|...||..:.:.. ..:|:|||:|:||||||
  Fly   181 ---TNNFDEPQGKRFKHESSCSPNSSPLKNHSSGGPVEITPLINDYADSSKRIRTAFTSTQLLEL 242

  Fly   214 EKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSD 278
            |:||..|.||.|.||||||..|.|:|:|||:||||||:|.|                ||      
  Fly   243 EREFSHNAYLSRLRRIEIANRLRLSEKQVKIWFQNRRVKQK----------------KG------ 285

  Fly   279 SNSNSKKSCQGCELPSDDIPDSTSNSRGHNNNTPSATNNNP 319
                      |.|.|       |.|...::|.:|.|:..:|
  Fly   286 ----------GSESP-------TFNLSTNSNGSPQASPVSP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 48/109 (44%)
Homeobox 202..254 CDD:278475 36/51 (71%)
indNP_996087.2 Homeobox 231..283 CDD:278475 36/51 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439787
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 1 0.900 - - E2759_KOG0489
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.