DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and CG30480

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001260976.1 Gene:CG30480 / 246640 FlyBaseID:FBgn0050480 Length:920 Species:Drosophila melanogaster


Alignment Length:224 Identity:35/224 - (15%)
Similarity:55/224 - (24%) Gaps:119/224 - (53%)


- Green bases have known domain annotations that are detailed below.


  Fly   554 NGTPYLNHQQQHHHHAQHHQQQQHHQNHVADFEGPVNGPSNFNNGAYYDNMSFQQQAQAHQHQTV 618
            :|:....|:..||||..||    ||:.                          |:..:....:.|
  Fly    35 DGSVAPKHRHHHHHHRHHH----HHER--------------------------QENVEVVATEEV 69

  Fly   619 VFQQQQPHQPAAINHQHMHHLGNGETYSALGLQMENCEGYNNFGAAGTGGGYYEAGQQPPIPATH 683
            :..:..|.     :.:|.||                               .......||:|.| 
  Fly    70 ILVENAPK-----SRKHHHH-------------------------------KQRTSPPPPLPQT- 97

  Fly   684 GHGHHPHHVQVPAQAHAPIHAHHNSAAIPGGVGVGPP---PSHIHGFAINGGPAVQGQAFGNNGS 745
                                              .||   |:...||.:...|    |||.|..|
  Fly    98 ----------------------------------SPPFLTPTEEVGFNVVWEP----QAFWNQPS 124

  Fly   746 TAAGT-----------AAISGLENSNSSD 763
            ....|           .|:..::.:::||
  Fly   125 PNPSTDLDLSQDNEVVDAVETMDTTSASD 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863
Homeobox 202..254 CDD:278475
CG30480NP_001260976.1 PRK10263 <499..>757 CDD:236669
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439786
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.