DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and gbx2

DIOPT Version :10

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_694496.1 Gene:gbx2 / 245948 ZFINID:ZDB-GENE-020509-2 Length:342 Species:Danio rerio


Alignment Length:89 Identity:42/89 - (47%)
Similarity:53/89 - (59%) Gaps:6/89 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 NNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVW 245
            |..|:.:.|      |..||.|||:|:.||||||||||..|||....|.:||.:|.|:|.|||:|
Zfish   230 NGAGNTTST------GKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIW 288

  Fly   246 FQNRRMKHKRQTLSKTDDEDNKDS 269
            |||||.|.||......:.:..:.|
Zfish   289 FQNRRAKWKRVKAGNVNSKTGEPS 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 Homeodomain 199..255 CDD:459649 35/55 (64%)
gbx2NP_694496.1 Homeodomain 242..298 CDD:459649 35/55 (64%)

Return to query results.
Submit another query.