DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and Hoxc8

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001170797.2 Gene:Hoxc8 / 24460 RGDID:2821 Length:242 Species:Rattus norvegicus


Alignment Length:224 Identity:72/224 - (32%)
Similarity:98/224 - (43%) Gaps:40/224 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PNCDKRSADTAYWMTASEGGFINSQPSMAEFLNHLSPESPKIGTPVGSGAIGGVGVNVNV----- 139
            |....||....|....|..||.::...:.:|.:|            |:..|...|...|.     
  Rat    29 PQSVGRSHALVYGPGGSAPGFQHASHHVQDFFHH------------GTSGISNSGYQQNPCSLSC 81

  Fly   140 --NVGVGVGYPVGVVP-QTPDGMD---SVPEYPWMKEKKTSRKSSNNNNQGDNSITEFV-----P 193
              :.....||.  .:| |:..|..   ||.:||..|....:..|....:...||....:     |
  Rat    82 HGDASKFYGYE--ALPRQSLYGAQQEASVVQYPDCKSSANTNSSEGQGHLNQNSSPSLMFPWMRP 144

  Fly   194 ENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTL 258
            .....|..|..|:..|.|||||||.||.||.|.||||::.:|.|||||||:||||||||.|:   
  Rat   145 HAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKK--- 206

  Fly   259 SKTDDEDNKDSLKG--DDDQSDSNSNSKK 285
                 |:|||.|.|  |:::.:...|.::
  Rat   207 -----ENNKDKLPGARDEEKVEEEGNEEE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 48/112 (43%)
Homeobox 202..254 CDD:278475 35/51 (69%)
Hoxc8NP_001170797.2 Homeobox 153..206 CDD:395001 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.