DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and Vax2

DIOPT Version :10

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_036042.1 Gene:Vax2 / 24113 MGIID:1346018 Length:292 Species:Mus musculus


Alignment Length:171 Identity:56/171 - (32%)
Similarity:78/171 - (45%) Gaps:42/171 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 SITEFVPENGL----PRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQ 247
            :|.|.|...||    |:|.||::|..||..||.||...:|:....|.|:|..|:|:|.|||||||
Mouse    87 TIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQ 151

  Fly   248 NRRMKHKRQTLSKTDDEDNKDSLKGDDDQSDSNSNSKKSCQGCELPSDDIPDSTSN-----SRGH 307
            |||.|.|            ||..: |.::..|:|.|:..             :|||     .:|.
Mouse   152 NRRTKQK------------KDQSR-DLEKRASSSASEAF-------------ATSNVLRLLEQGR 190

  Fly   308 NNNTPSATNNNPSAGNLTPNSSLETGISSNLMGSTTVSASN 348
            ..:.|.|    ||...|||..   .|:.::..|::.|...|
Mouse   191 LLSVPRA----PSLLALTPGL---PGLPASHRGTSLVDPRN 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 Homeodomain 199..255 CDD:459649 28/55 (51%)
Vax2NP_036042.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..74
Homeodomain 103..159 CDD:459649 29/67 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..242 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.