DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and GSX1

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_663632.1 Gene:GSX1 / 219409 HGNCID:20374 Length:264 Species:Homo sapiens


Alignment Length:270 Identity:80/270 - (29%)
Similarity:118/270 - (43%) Gaps:67/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 QGVPP------VPSVLMVNKMTPN-CDKRSAD----TAYWMTASEGGFINSQPSMAEFLNHLSPE 117
            :|.||      ||....::.::|. |..|.|.    ....:|||:   ::..|. ...|..|...
Human    22 EGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVTASQ---LHGPPG-PPALPLLKAS 82

  Fly   118 SPKIGTPVGSGAIG--GVGVNVNVNVGVGVGYPVGVVPQTPDGMDSVPEYPWMKEKK---TSRKS 177
            .|..|:......:|  ...|:..|..|.........:.||        .||....::   .|..|
Human    83 FPPFGSQYCHAPLGRQHSAVSPGVAHGPAAAAAAAALYQT--------SYPLPDPRQFHCISVDS 139

  Fly   178 SNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQV 242
            |:|.          :|.:   :|:|||:|:|||||||:||..|.||.|.||||||..|:|:|:||
Human   140 SSNQ----------LPSS---KRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQV 191

  Fly   243 KVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSDSNSNS---KKSCQGCELPS---------- 294
            |:||||||:|||::.             ||.:.:......:   ..:.|||:..|          
Human   192 KIWFQNRRVKHKKEG-------------KGSNHRGGGGGGAGGGGSAPQGCKCASLSSAKCSEDD 243

  Fly   295 DDIPDSTSNS 304
            |::|.|.|:|
Human   244 DELPMSPSSS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 46/108 (43%)
Homeobox 202..254 CDD:278475 36/51 (71%)
GSX1NP_663632.1 SNAG domain. /evidence=ECO:0000250 1..20
Homeobox 151..204 CDD:395001 37/52 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..264 14/66 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.