DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and ceh-62

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_496326.2 Gene:ceh-62 / 187642 WormBaseID:WBGene00011069 Length:278 Species:Caenorhabditis elegans


Alignment Length:255 Identity:65/255 - (25%)
Similarity:105/255 - (41%) Gaps:66/255 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 TPDGMDSVPEYPWMKEKKTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHF 219
            ||..:.:.|..|...:...|..:.|..:                ||.||.::..|...||.|:..
 Worm    69 TPTPIIATPSIPEQPQPLQSPSAPNEKS----------------RRKRTTFSPEQATRLEAEYIG 117

  Fly   220 NKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSDSNSNSK 284
            :.|:.|.:|..:|.||.|:|.|||.||||||.|.||                  |.:|::.||  
 Worm   118 DSYMAREKRHLLAQSLKLSENQVKTWFQNRRAKDKR------------------DRKSENASN-- 162

  Fly   285 KSCQGCELPSDDIPDSTSNSRGHNNNTPSATNNNPSAGNLTPNSSLETGISSNLMGSTTVSASNV 349
                           .|||||..:.:..|::::.|     ||..:.:..:.:.:.     :||..
 Worm   163 ---------------HTSNSRRSSPSRKSSSDSTP-----TPTQATQFDMPTQIQ-----TASPP 202

  Fly   350 ISADSSV---ASSVSLDEDIEESSPIKVKKKDDGQVIKKEAVSTSSKASPFGYENSTPSL 406
            .:|||::   .|..|:.:.||:....::....|  :::....|.||...|..:..|||.|
 Worm   203 TTADSAIFPPTSPESIIQKIEQFPSNQILPNFD--ILQTYLQSLSSSQIPLQFVPSTPPL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 30/105 (29%)
Homeobox 202..254 CDD:278475 24/51 (47%)
ceh-62NP_496326.2 Homeobox 99..152 CDD:278475 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.