DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and mab-5

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_498695.1 Gene:mab-5 / 176091 WormBaseID:WBGene00003102 Length:200 Species:Caenorhabditis elegans


Alignment Length:234 Identity:67/234 - (28%)
Similarity:99/234 - (42%) Gaps:78/234 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SADTAYW---------MTASEGGFINSQPSMA-----------EFLNHLSPESPK---------- 120
            :.|.:||         .:||.|...::..|.|           |..||....:.|          
 Worm     8 TGDDSYWAGAGTTASSQSASSGTSASASSSAAAAAAANNLKTYELYNHTYMNNMKHMLAAGWMDN 72

  Fly   121 IGTPVGSGAIGGVGVNVNVNVGVGVGYPVGVVPQTPDGMDSV--PEYPWMKEKKTSRKSSNNNNQ 183
            ...|.....:.....|..               :|...|.::  |.:||||             .
 Worm    73 SSNPFAYNPLQATSANFG---------------ETRTSMPAISQPVFPWMK-------------M 109

  Fly   184 GDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQN 248
            |.       .:.|..:|.|..|:.:|.||||||||::|||.|.||.||:.:|.|||||||:||||
 Worm   110 GG-------AKGGESKRTRQTYSRSQTLELEKEFHYHKYLTRKRRQEISETLHLTERQVKIWFQN 167

  Fly   249 RRMKHKRQT-----LSKTDDEDNKDSLKGDDDQSDSNSN 282
            ||||||::.     .:::|:|.|:      |:|::.:|:
 Worm   168 RRMKHKKEAKGEGGSNESDEESNQ------DEQNEQHSS 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 45/110 (41%)
Homeobox 202..254 CDD:278475 35/51 (69%)
mab-5NP_498695.1 Homeobox 120..173 CDD:278475 35/52 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.