DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and ceh-13

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_498655.1 Gene:ceh-13 / 176069 WormBaseID:WBGene00000437 Length:202 Species:Caenorhabditis elegans


Alignment Length:208 Identity:67/208 - (32%)
Similarity:93/208 - (44%) Gaps:40/208 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 WMTASEGGFINSQPSMAEFLNHLSPESPKIGTP----VGSGAI------GGVGVNVNVNVGVGVG 146
            |.|..  .:..|.||....||| .|.......|    :|:|.:      .|:....:.:......
 Worm    18 WPTTH--SYYPSVPSSYSPLNH-HPADIWAAHPSNYIMGNGHVSPPATASGLSPPASRSSNSSAE 79

  Fly   147 YPVGVVPQTPDGMDSVPEYPWMKEKKTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLL 211
            .|.||.....:      .|.||..|::.|.::...        :.:.|||..   ||.:|..||.
 Worm    80 LPTGVTASQHN------TYKWMHTKRSQRPAAPKK--------KVIDENGTN---RTNFTTHQLT 127

  Fly   212 ELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQ 276
            |||||||..||:.|.||.|||::|.|.|.|||:||||||||.|::       |..|..|..:..:
 Worm   128 ELEKEFHTAKYVNRTRRTEIASNLKLQEAQVKIWFQNRRMKEKKR-------EKEKAFLARNTWE 185

  Fly   277 SDSNSNSKKSCQG 289
            |:|.::   ||.|
 Worm   186 SNSPTS---SCSG 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 44/105 (42%)
Homeobox 202..254 CDD:278475 34/51 (67%)
ceh-13NP_498655.1 Homeobox 118..164 CDD:278475 28/45 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.