DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and ceh-7

DIOPT Version :10

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_495848.1 Gene:ceh-7 / 174391 WormBaseID:WBGene00000432 Length:84 Species:Caenorhabditis elegans


Alignment Length:60 Identity:27/60 - (45%)
Similarity:38/60 - (63%) Gaps:1/60 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 LPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQ 256
            :||| ||.:|..||..||..|..::|:....|..:|..|.|.|.|||:||||||::.:|:
 Worm    23 IPRR-RTTFTVEQLYLLEMYFAQSQYVGCDERERLARILSLDEYQVKIWFQNRRIRMRRE 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 Homeodomain 199..255 CDD:459649 25/55 (45%)
ceh-7NP_495848.1 Homeodomain 25..80 CDD:459649 25/55 (45%)

Return to query results.
Submit another query.