DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and Meox2

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_032610.1 Gene:Meox2 / 17286 MGIID:103219 Length:303 Species:Mus musculus


Alignment Length:236 Identity:78/236 - (33%)
Similarity:105/236 - (44%) Gaps:83/236 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 INSQPSMAEFLNHLSPES---PKIGT--PV---GSGAIGGVGVNVNVNVGVGVGYPVGVVPQTPD 157
            ::|.||.|.....|.|:|   |::|:  ||   .|.::|.                     .||.
Mouse    96 MSSPPSAARHSLCLQPDSGGPPELGSSPPVLCSNSSSLGS---------------------STPT 139

  Fly   158 GMDSVP-EY------PWMKEKK--TSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLEL 213
            |....| :|      |...||:  :.|||.::::|..|..:|.   |..||:.|||:|..|:.||
Mouse   140 GAACAPGDYGRQALSPADVEKRSGSKRKSDSSDSQEGNYKSEV---NSKPRKERTAFTKEQIREL 201

  Fly   214 EKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKR----------------------- 255
            |.||..:.||.|.||.|||.:||||||||||||||||||.||                       
Mouse   202 EAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMKWKRVKGGQQGAAAREKELVNVKKGTL 266

  Fly   256 ----------QTLSKTDD----EDNKDSLKGDDDQSDSNSN 282
                      .||.:|.|    ||::||     |.|..:::
Mouse   267 LPSELSGIGAATLQQTGDSLANEDSRDS-----DHSSEHAH 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 57/144 (40%)
Homeobox 202..254 CDD:278475 36/51 (71%)
Meox2NP_032610.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..191 30/118 (25%)
Homeobox 190..242 CDD:278475 36/51 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 278..303 10/30 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.