DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and Meox1

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:XP_036012267.1 Gene:Meox1 / 17285 MGIID:103220 Length:271 Species:Mus musculus


Alignment Length:187 Identity:42/187 - (22%)
Similarity:57/187 - (30%) Gaps:54/187 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VQTGQTSLPVGGCGGAGVVGGVGGVGVSVGQP------GIGQQGVPPVPSVLMVNKMTPNCDKRS 86
            |:..|...||.||               :..|      ..|....||.|.........|      
Mouse     9 VRNPQPPAPVWGC---------------LRNPHSEDSSASGLSHYPPTPFSFHQKSDFP------ 52

  Fly    87 ADTAY--WMTASEGGFINSQPSMAEFLNHLSPESPKIGTPVGSGAIGGVGVNVNVNVG-----VG 144
            |..||  :..:......:|.|......|...|..|:  ||.....|...|..:|:...     :|
Mouse    53 ATAAYPDFSASCLAATPHSLPRTERIFNEQHPAFPQ--TPDWHFPISEAGQRLNLGPAGSAREMG 115

  Fly   145 VGYPVGVVPQTPDGMDSVPEYPWM-------KEKKTSRKSSNNNNQGDNSITEFVPE 194
            .|.| |:|    ||...:.|...:       .|||:||:....:.|      ..|||
Mouse   116 AGSP-GLV----DGTAGLGEDCMVLGTIANETEKKSSRRKKERSGQ------SLVPE 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 9/34 (26%)
Homeobox 202..254 CDD:278475
Meox1XP_036012267.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.