DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and Hoxd4

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_034599.2 Gene:Hoxd4 / 15436 MGIID:96208 Length:250 Species:Mus musculus


Alignment Length:272 Identity:85/272 - (31%)
Similarity:102/272 - (37%) Gaps:106/272 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PVGGCGGAGVVGGV---------GGVGVSVGQPGIGQQGVPPVPSVLMVNKMTPNCDKRSADTAY 91
            |.|| ||.|....:         .|.|...|.||......||.|                     
Mouse    61 PFGG-GGPGPGSALPARGHGQEPSGPGSHYGAPGERCPAPPPAP--------------------- 103

  Fly    92 WMTASEGGFINSQPSMAEFLNHLSPESPKIGTPVGSGAIGGVGVNVNVNVGVGVGYPVGVVPQTP 156
                ..|....|||:        .|:.|..||.:...|:                          
Mouse   104 ----LPGARACSQPT--------GPKQPPPGTALKQPAV-------------------------- 130

  Fly   157 DGMDSVPEYPWMKEKKTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNK 221
                   .||||  ||....|.|.|..|           |.|:|.|||||..|:||||||||||:
Mouse   131 -------VYPWM--KKVHVNSVNPNYTG-----------GEPKRSRTAYTRQQVLELEKEFHFNR 175

  Fly   222 YLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDEDNK-DSLKGDDDQSDSNSNSKK 285
            ||.|.||||||.:|.|:|||:|:||||||||.|:         |:| .:.||       .|:|..
Mouse   176 YLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKK---------DHKLPNTKG-------RSSSSS 224

  Fly   286 SCQGCELPSDDI 297
            ||.....|...:
Mouse   225 SCSSSAAPGQHL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 54/106 (51%)
Homeobox 202..254 CDD:278475 39/51 (76%)
Hoxd4NP_034599.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..126 22/98 (22%)
Antp-type hexapeptide 131..136 4/6 (67%)
Homeobox 155..208 CDD:278475 39/52 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..250 9/34 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.