DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and Hoxd13

DIOPT Version :10

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_032301.2 Gene:Hoxd13 / 15433 MGIID:96205 Length:339 Species:Mus musculus


Alignment Length:65 Identity:31/65 - (47%)
Similarity:45/65 - (69%) Gaps:1/65 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 RRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDD 263
            |:.|..||..||.|||.|:..||::.:.:|..|:|:.:|:||||.:||||||:|.|: .:||..|
Mouse   273 RKKRVPYTKLQLKELENEYAINKFINKDKRRRISAATNLSERQVTIWFQNRRVKDKK-IVSKLKD 336

  Fly   264  263
            Mouse   337  336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 Homeodomain 199..255 CDD:459649 27/55 (49%)
Hoxd13NP_032301.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
HoxA13_N <121..168 CDD:463521
Homeodomain 273..329 CDD:459649 27/55 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.