DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and Hoxb6

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:XP_006532355.1 Gene:Hoxb6 / 15414 MGIID:96187 Length:309 Species:Mus musculus


Alignment Length:251 Identity:80/251 - (31%)
Similarity:102/251 - (40%) Gaps:79/251 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PPVP-SVLMVNKMTPNCDKRSADTAYWMTASEG--GFINSQP----SMAEFLNHL-SPESPKIGT 123
            ||:| |...||...|            :|.:.|  .|:...|    ..|:.|.|. :|..|..|.
Mouse    82 PPLPMSSYFVNSTFP------------VTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQ 134

  Fly   124 PVGSGAI-------GGVGVNVNVNVG---------------VGVGYP---------------VGV 151
            ..|..|.       ||.|.....:.|               .|...|               ..|
Mouse   135 DKGFAASSYYPPAGGGYGRAAPCDYGPAPAFYREKDAACALSGADEPPPFHPEPRKSDCAQDKSV 199

  Fly   152 VPQTPDGMDSVPEYPWMKEKKTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKE 216
            ..:|.:...|.|.||||:...:...||            |.|..   ||.|..||..|.||||||
Mouse   200 FGETEEQKCSTPVYPWMQRMNSCNSSS------------FGPSG---RRGRQTYTRYQTLELEKE 249

  Fly   217 FHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQT-------LSKTDDED 265
            ||:|:||.|.||||||.:|.|||||:|:||||||||.|:::       ||..::|:
Mouse   250 FHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKLLSASQLSAEEEEE 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 48/105 (46%)
Homeobox 202..254 CDD:278475 37/51 (73%)
Hoxb6XP_006532355.1 Homeobox 235..288 CDD:365835 37/52 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.