DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and Hoxb3

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001073338.1 Gene:Hoxb3 / 15410 MGIID:96184 Length:433 Species:Mus musculus


Alignment Length:359 Identity:104/359 - (28%)
Similarity:144/359 - (40%) Gaps:79/359 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GGVGVSVGQPGIGQQGVPPVPSVLMVNKMTPNCDKRSADTAYWMTASEGGFINSQP-SMAEFLN- 112
            ||.....|..|.|..| ||.|.......:..:. :|||       .|.....|:.| :.::.|| 
Mouse    16 GGYSSYPGSNGFGYDG-PPQPPFQAATHLEGDY-QRSA-------CSLQSLGNAAPHAKSKELNG 71

  Fly   113 -----HLSPESPKIGTPVGSGAIGGVGVNVNVNVGVGVGYPVGVVPQTPDGMDSV---PEYPWMK 169
                 .|:||  .:..|.||........:...|...|.|......|:...|.:|.   ..:||||
Mouse    72 SCMRPGLAPE--PLPAPPGSPPPSAAPTSTTSNSNNGGGPSKSGPPKCGAGSNSTLTKQIFPWMK 134

  Fly   170 EKKTSRKSSNNN--------------------------------NQGDNSITEFVPENGLPRRLR 202
            |.:.:.|..|::                                ..||.|    .|.:...:|.|
Mouse   135 ESRQTSKLKNSSPGTAEGCGGGGGGGGGGGGGGGGSSGGGGGGGGGGDKS----PPGSAASKRAR 195

  Fly   203 TAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDEDNK 267
            ||||:.||:|||||||||:|||||||:|:|..|:|:|||:|:||||||||:|:...:|     ..
Mouse   196 TAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKAK-----GL 255

  Fly   268 DSLKGDDDQSDSNSNSKKSCQG------CELPSDDIPDSTSNSRGHNNNTPSATNNNPSAGNL-- 324
            .|..|....:.|.....:|..|      ...||.|.|...:..:||.|.....:|..|.....  
Mouse   256 ASSSGGPSPAGSPPQPMQSTAGFMNALHSMTPSYDSPSPPAFGKGHQNAYALPSNYQPPLKGCGA 320

  Fly   325 ------TPNSSLETGI---SSNLMGSTTVSASNV 349
                  ||.|..|..:   :....|:.|:..|.|
Mouse   321 PQKYPPTPASEYEPHVLQANGGAYGTPTMQGSPV 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 53/137 (39%)
Homeobox 202..254 CDD:278475 39/51 (76%)
Hoxb3NP_001073338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 13/62 (21%)
Antp-type hexapeptide 129..134 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..195 7/62 (11%)
Homeobox 195..248 CDD:365835 39/52 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..276 5/31 (16%)
DUF4074 369..431 CDD:372548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.