DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and Hoxa6

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_034584.1 Gene:Hoxa6 / 15403 MGIID:96178 Length:232 Species:Mus musculus


Alignment Length:265 Identity:82/265 - (30%)
Similarity:108/265 - (40%) Gaps:81/265 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LNPLQVQTGQTSLPVGGCGGAGVVGGVGGVGVSVGQPGIGQQGVPPVPSVLMVNKMT----PNCD 83
            |.|.....|.:|||                ..:...|...||.    .|||..|:.:    .:|.
Mouse    35 LRPFPASYGASSLP----------------DKTYTSPCFYQQS----NSVLACNRASYEYGASCF 79

  Fly    84 KRSADTAYWMTASEGGFINSQPSMAEFLNHLSPE---SPKIGTPVGSGAIGGVGVNVNVNVGVGV 145
            ....|.:   .||..| .|.|....::| |.|||   .|       .|::.|..::         
Mouse    80 YSDKDLS---GASPSG-NNKQRGPGDYL-HFSPEQQYKP-------DGSVQGKALH--------- 123

  Fly   146 GYPVGVVPQTPDGMD---SVPEYPWMKEKKTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTN 207
                      .:|.|   :.|.|||| ::..|...:...:.|              ||.|..||.
Mouse   124 ----------EEGTDRKYTSPVYPWM-QRMNSCAGAVYGSHG--------------RRGRQTYTR 163

  Fly   208 TQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKG 272
            .|.||||||||||:||.|.||||||.:|.|||||:|:||||||||.|     |.:...|.....|
Mouse   164 YQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWK-----KENKLINSTQASG 223

  Fly   273 DDDQS 277
            :|.::
Mouse   224 EDSEA 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 47/105 (45%)
Homeobox 202..254 CDD:278475 38/51 (75%)
Hoxa6NP_034584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..126 13/65 (20%)
Antp-type hexapeptide 135..140 4/5 (80%)
Homeobox 158..210 CDD:278475 38/51 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.