DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and Gbx2

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_034392.1 Gene:Gbx2 / 14472 MGIID:95668 Length:348 Species:Mus musculus


Alignment Length:268 Identity:78/268 - (29%)
Similarity:102/268 - (38%) Gaps:66/268 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SLPVGGCGGAGVVGGVGGVGVSVGQ-PGIGQQGVPPVPSVLMVNKMTP-------NCDKRSADTA 90
            |||.|.|  :.:..|:......:.. || |....|.........|..|       |.||..|..|
Mouse    85 SLPTGFC--SSLAQGMALTSTLMATLPG-GFSASPQHQEAAAARKFAPQPLPGGGNFDKAEALQA 146

  Fly    91 YWMTASEG-GFINSQPSMAEFLNHLSPESPKIGTPVGSGAIGGVGVNVNVNVGVGVGYPVGVVPQ 154
               .|.:| .|:..:.|:..|         .....|.:..:|.|.         |.|.....|..
Mouse   147 ---DAEDGKAFLAKEGSLLAF---------SAAEAVQASLVGAVR---------GQGKDESKVED 190

  Fly   155 TPDGMDSVPEYPWMKEKKTSRK-----SSNNNNQGDNSITEFVP------------------ENG 196
            .|.|          ||:..|.:     ||::|..|..:..|..|                  ..|
Mouse   191 DPKG----------KEESFSLESDVDYSSDDNLPGQTAHKEEDPGHALEETPQSGGAAGSTTSTG 245

  Fly   197 LPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKT 261
            ..||.|||:|:.||||||||||..|||....|.:||.:|.|:|.|||:||||||.|.||......
Mouse   246 KNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAGNA 310

  Fly   262 DDEDNKDS 269
            :.:..:.|
Mouse   311 NSKTGEPS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 48/125 (38%)
Homeobox 202..254 CDD:278475 33/51 (65%)
Gbx2NP_034392.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..81
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..139 5/27 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..251 17/90 (19%)
Homeobox 250..304 CDD:395001 33/53 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.