DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and Gbx2

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_446160.1 Gene:Gbx2 / 114500 RGDID:621866 Length:348 Species:Rattus norvegicus


Alignment Length:272 Identity:79/272 - (29%)
Similarity:102/272 - (37%) Gaps:74/272 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SLPVGGCGGAGVVGGVGGVGVSVGQ-PGIGQQGVPPVPSVLMVNKMTP-------NCDKR---SA 87
            |||.|.|  :.:..|:......:.. || |....|.........|..|       |.||.   .|
  Rat    85 SLPTGFC--SSLAQGMALTSTLMATLPG-GFSASPQHQEAAAARKFAPQPLPGGGNFDKSEALQA 146

  Fly    88 DTAYWMTASEGG--FINSQPSMAEFLNHLSPESPKIGTPVGSGAIGGVGVNVNVNVGVGVGYPVG 150
            ||       |.|  |:..:.|:..|         .....|.:..:|.|.         |.|....
  Rat   147 DT-------EDGKAFLAKEGSLLAF---------SAAEAVQASLVGAVR---------GQGKDES 186

  Fly   151 VVPQTPDGMDSVPEYPWMKEKKTSRK-----SSNNNNQGDNSITEFVP----------------- 193
            .|...|.|          ||:..|.:     ||::|..|..:..|..|                 
  Rat   187 KVEDDPKG----------KEESFSLESDVDYSSDDNLPGQTAHKEEDPGHALEETPQSGGAAGST 241

  Fly   194 -ENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQT 257
             ..|..||.|||:|:.||||||||||..|||....|.:||.:|.|:|.|||:||||||.|.||..
  Rat   242 TSTGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVK 306

  Fly   258 LSKTDDEDNKDS 269
            ....:.:..:.|
  Rat   307 AGNANSKTGEPS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 48/125 (38%)
Homeobox 202..254 CDD:278475 33/51 (65%)
Gbx2NP_446160.1 Homeobox 250..304 CDD:395001 33/53 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.