DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and hoxc4

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:XP_002936684.1 Gene:hoxc4 / 100486039 XenbaseID:XB-GENE-967141 Length:297 Species:Xenopus tropicalis


Alignment Length:206 Identity:69/206 - (33%)
Similarity:89/206 - (43%) Gaps:92/206 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 YPWMKEKKTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRI 229
            |||||:...|  |.|.|..|           |.|:|.|||||..|:||||||||:|:||.|.|||
 Frog   173 YPWMKKIHVS--SVNPNYTG-----------GEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRI 224

  Fly   230 EIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSDSNSNSKKSCQGCELPS 294
            |||.||.|:|||:|:||||||||.|:         |::                           
 Frog   225 EIAHSLCLSERQIKIWFQNRRMKWKK---------DHR--------------------------- 253

  Fly   295 DDIPDSTSNSRGHNNNTPSATNNNPSAGNLTPNSSLETGISSNLMGSTTVSASNVISADSSVASS 359
                                          .||:.:.:..|||       ::||:|      |||
 Frog   254 ------------------------------LPNTKVRSNASSN-------ASSNII------ASS 275

  Fly   360 VSLDEDIEESS 370
            .:..||:.:||
 Frog   276 AAASEDLSQSS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 51/105 (49%)
Homeobox 202..254 CDD:278475 39/51 (76%)
hoxc4XP_002936684.1 Homeobox 196..250 CDD:365835 39/53 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.