DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and Hoxb2

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:XP_002727852.1 Gene:Hoxb2 / 100361765 RGDID:2319509 Length:355 Species:Rattus norvegicus


Alignment Length:342 Identity:121/342 - (35%)
Similarity:160/342 - (46%) Gaps:70/342 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EGGFINSQPSMAEFLNH------------------LSPESPKI-----GTPVGSGAIGGVGVNVN 138
            |.||||||||:||.|..                  :.|..|.:     ...:|:..:...|....
  Rat     8 EIGFINSQPSLAECLTSFPAVLETFQTSSIKESTLIPPPPPPLEQTFPSLQLGASTLQRPGSQKP 72

  Fly   139 VNVGVGVGYPVGVVPQTPDGMDSVPEYPWMKEKKTSRKSSNN-------------NNQGDNSITE 190
            ...|..: .|...:|..|    ..||:|||||||:::|.|.:             :..|..|...
  Rat    73 AGDGPAL-RPPPPLPVAP----PAPEFPWMKEKKSAKKPSQSAATPSPAASSVRASGVGSPSDGP 132

  Fly   191 FVPENG--LPRRLRTAYTNTQLLELEKEFHFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKH 253
            .:||:|  ..||||||||||||||||||||||||||||||:||||.|||||||||||||||||||
  Rat   133 GLPESGGSGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKH 197

  Fly   254 KRQTLSKTDDEDNKDSLKGDDDQ---------SDSNSNSKKSCQGCELPSDDIPDSTSNSRGHNN 309
            ||||..:...:.....|...||.         |..:..|.:..:.|.||:    ::....||...
  Rat   198 KRQTQHREPPDGEPGGLSAQDDAGEPAEEPTVSPGDVASHRLREACFLPA----EAAQGPRGAPP 258

  Fly   310 NTPSATNNNPSAGNLTPNSSL--ETGISSNLM---------GSTTVSASNVISADSSVASSVSLD 363
            ..|.||... |.|..:|..::  ..|:.|..:         .|..:...|..:|||.:..|..|.
  Rat   259 PLPPATALE-SVGASSPGCTMLRAGGLQSEPLPEDACPERQDSPFLPDLNFFAADSCLPMSGGLS 322

  Fly   364 EDIEES--SPIKVKKKD 378
            ..::.|  ||:...:::
  Rat   323 PSLQGSLDSPVPFSEEE 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 70/120 (58%)
Homeobox 202..254 CDD:278475 49/51 (96%)
Hoxb2XP_002727852.1 Homeobox 146..198 CDD:278475 49/51 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352770
Domainoid 1 1.000 117 1.000 Domainoid score I5764
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 1 1.000 - - otm44922
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45664
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2356
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.800

Return to query results.
Submit another query.