DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pb and hoxb5

DIOPT Version :9

Sequence 1:NP_476669.3 Gene:pb / 40826 FlyBaseID:FBgn0051481 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001094494.1 Gene:hoxb5 / 100113366 XenbaseID:XB-GENE-1005991 Length:258 Species:Xenopus tropicalis


Alignment Length:245 Identity:77/245 - (31%)
Similarity:97/245 - (39%) Gaps:83/245 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GVGVSVGQPG-----IGQQGVPPVPSVLMVNKMTP-------NCDKRSADTAYWMTASEGGFINS 103
            |:.:||.:..     .|....|...|....|:..|       .|.|...|     ..|......|
 Frog    54 GMDLSVSRAAASSSHYGDSAFPGQESRFRANQSCPLATPDPLPCAKSHKD-----ELSPTDPATS 113

  Fly   104 QPSMAEFL----NHLSPESPKIGTPVGS------------GAIGGVGVNVNVNVGVGVGYPVGVV 152
            ..|.|:|.    ...|.|:.:..||..|            ||.|..|.|                
 Frog   114 AGSSAQFTEVEETSASSETEESSTPRSSAPPRALQENSSPGAAGTDGQN---------------- 162

  Fly   153 PQTPDGMDSVPEYPWMKEKKTSRKSSNNNNQGDNSITEFVPENGLPRRLRTAYTNTQLLELEKEF 217
            ||.         :|||:     :...|::..|.:.           :|.|||||..|.|||||||
 Frog   163 PQI---------FPWMR-----KLHINHDMTGPDG-----------KRARTAYTRYQTLELEKEF 202

  Fly   218 HFNKYLCRPRRIEIAASLDLTERQVKVWFQNRRMKHKRQTLSKTDDEDNK 267
            |||:||.|.||||||.:|.|:|||:|:||||||||.|:         |||
 Frog   203 HFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKK---------DNK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pbNP_476669.3 COG5576 168..274 CDD:227863 47/100 (47%)
Homeobox 202..254 CDD:278475 39/51 (76%)
hoxb5NP_001094494.1 Homeobox 187..240 CDD:365835 39/52 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.