DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccp84Aa and CG34462

DIOPT Version :9

Sequence 1:NP_649683.1 Gene:Ccp84Aa / 40825 FlyBaseID:FBgn0004783 Length:205 Species:Drosophila melanogaster
Sequence 2:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster


Alignment Length:260 Identity:54/260 - (20%)
Similarity:88/260 - (33%) Gaps:79/260 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FVFALAFVAVASAGYAPIAAP-----QVYHAAPAVATYAHAPVAVAQKVVVKAA-----EEYDPH 59
            |||.|     .:..||.::.|     :||          :.|....:|...|..     |.|.|:
  Fly    11 FVFVL-----ITKVYAALSNPLSSKIEVY----------NQPEVTPEKERAKVRNYFVHEPYGPN 60

  Fly    60 PQYRFSYGVDDKLTGDNKGQVEER--DGDVVRGEYSLIDADGYKRIVQYTADPINGFNAVVN--- 119
             .|.|.|.::|..|.:::.:.|:|  :|. ::|.|.....||...:.:|.|....|::|.:.   
  Fly    61 -TYSFGYEINDPQTQNSQFREEKRFVNGS-IQGSYGYARPDGRIEVTKYMAKEDGGYSAQIQIFK 123

  Fly   120 -REPLVKA-------------------------------VAVAPVVKTVAAPVAQYAAPAVAH-- 150
             .:..||:                               |.|:.|...||..:.|.....:.|  
  Fly   124 AGDEKVKSVWPTERPDILVERSKSDAPSNITWDPKSHLNVTVSHVADHVAQQLKQQHGLDLNHID 188

  Fly   151 ----YAAPAVVKTV---APVAHYAAPAVVKTVAPVAHYAAPAAYATYAAPTHYAAP----AVAYH 204
                ...|||:..:   .|........::....|:..:..||...|..|.|  |.|    :..||
  Fly   189 VTKDVLKPAVLDVIQGKEPTKGRPVQNLIPQHFPIVPFQLPADQETTKATT--AEPQKTESSKYH 251

  Fly   205  204
              Fly   252  251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccp84AaNP_649683.1 Chitin_bind_4 62..114 CDD:278791 14/53 (26%)
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:278791 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.